PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI03G17220.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 366aa    MW: 38633.4 Da    PI: 6.6898
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI03G17220.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.74.8e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l + ++++G g+W+++++  g+ R++k+c++rw +yl
  OMERI03G17220.1 14 RGLWSPEEDEKLMNHIAKYGHGCWSSVPKLAGLERCGKSCRLRWINYL 61
                     788*******************************************97 PP

2Myb_DNA-binding53.94.2e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg +++eE++l+++++ +lG++ W+ Ia+ ++ gRt++++k++w++y
  OMERI03G17220.1  67 RGTFSQEEEDLIIQLHSMLGNK-WSQIAAQLP-GRTDNEVKNFWNSY 111
                      899*******************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.7E-27564IPR009057Homeodomain-like
PROSITE profilePS5129419.139961IPR017930Myb domain
SuperFamilySSF466894.49E-3012108IPR009057Homeodomain-like
SMARTSM007173.1E-131363IPR001005SANT/Myb domain
PfamPF002491.5E-151461IPR001005SANT/Myb domain
CDDcd001671.36E-111761No hitNo description
PROSITE profilePS5129427.23862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-2665116IPR009057Homeodomain-like
SMARTSM007172.0E-1666114IPR001005SANT/Myb domain
PfamPF002494.0E-1667111IPR001005SANT/Myb domain
CDDcd001673.06E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MAKQSCCHKK KLRRGLWSPE EDEKLMNHIA KYGHGCWSSV PKLAGLERCG KSCRLRWINY  60
LRPDLKRGTF SQEEEDLIIQ LHSMLGNKWS QIAAQLPGRT DNEVKNFWNS YIKKKLRDRG  120
IDPATHKPLA ADTATTAANT TAAVAVAAAA SRSTATCRAV FSDAELIPTA AAVQQQHAPL  180
VGAMQLVDGI KMPLDDYWPA AAAAAAPSSS TTTFSAYHHA LSMQQQAAAG CGGGAAFDMD  240
ALSHCGVVVA PSASSSSTLT SMAGLSPAAA DAAEQSANVA AAATNLQPWL DLGHANPVAT  300
MDHYAGVLDE LRWSDYFDGA YQAATTATHG GALQGQCLYD GGGGGGGKDV DDAVQFVDVH  360
SLSNWC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-30121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0872200.0AC087220.9 Oryza sativa chromosome 3 BAC OSJNBb0097F01 genomic sequence, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629523.11e-170PREDICTED: myb-related protein Zm38-like
TrEMBLA0A0E0D1760.0A0A0E0D176_9ORYZ; Uncharacterized protein
STRINGBGIOSGA010658-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30923385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G57560.13e-76myb domain protein 50